PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim08g083130.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 197aa    MW: 23141.1 Da    PI: 5.0663
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim08g083130.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.21.8e-202376356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         R++f++eq++ Le++Fe ++ p  +++++LAk+lgL+ rqV +WFqN+Ra+ k
  Sopim08g083130.0.1 23 MRRRFNDEQIKSLENMFETESRPELRTKQQLAKRLGLQPRQVAIWFQNKRARSK 76
                        699*************************************************99 PP

2HD-ZIP_I/II101.28.9e-3324114393
         HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                         +rr+++eq+k+LE++Fe+e++ e + K++la++Lglqprqva+WFqn+RAR k+kqlE +y++L+ +yd+l ++ e L+ke+e+L  +l++
  Sopim08g083130.0.1  24 RRRFNDEQIKSLENMFETESRPELRTKQQLAKRLGLQPRQVAIWFQNKRARSKSKQLELEYRMLQISYDNLGSKYELLKKEHESLLIQLQR 114
                         79***********************************************************************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.11E-181080IPR009057Homeodomain-like
PROSITE profilePS5007117.7181878IPR001356Homeobox domain
SMARTSM003892.6E-162082IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-182384IPR009057Homeodomain-like
PfamPF000469.0E-182376IPR001356Homeobox domain
CDDcd000863.60E-152479No hitNo description
PRINTSPR000317.2E-64958IPR000047Helix-turn-helix motif
PROSITE patternPS0002705376IPR017970Homeobox, conserved site
PRINTSPR000317.2E-65874IPR000047Helix-turn-helix motif
PfamPF021831.5E-1178119IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MAPTNSDMIW GESIMSSKCN DNMRRRFNDE QIKSLENMFE TESRPELRTK QQLAKRLGLQ  60
PRQVAIWFQN KRARSKSKQL ELEYRMLQIS YDNLGSKYEL LKKEHESLLI QLQRLKKLME  120
KDDNEKDVNK KSETEVKQDD FAPEFGSRGI DYLRAESDIL DMAQIADGLS EIENEFNFES  180
RTFLHDTGCT SPLWEF*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092610.0AP009261.1 Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0005L01, complete sequence.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004245456.21e-144PREDICTED: homeobox-leucine zipper protein ATHB-7-like
SwissprotP468972e-38ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLK4CPV91e-144K4CPV9_SOLLC; Uncharacterized protein
STRINGSolyc08g083130.2.11e-143(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA102732125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.17e-39homeobox 7